IOVS
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
QUICK SEARCH:   [advanced]


     

(Investigative Ophthalmology and Visual Science. 2003;44:1275-1281.)
© 2003 by The Association for Research in Vision and Ophthalmology, Inc.
doi:10.1167/iovs.02-0895
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kondo, H.
Right arrow Articles by Hayashi, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kondo, H.
Right arrow Articles by Hayashi, K.

Diagnosis of Autosomal Dominant Retinitis Pigmentosa by Linkage-Based Exclusion Screening with Multiple Locus-Specific Microsatellite Markers

Hiroyuki Kondo,1 Tomoko Tahira,2 Atsushi Mizota,3 Emiko Adachi-Usami,3 Kenji Oshima,1 and Kenshi Hayashi2

1From the Department of Ophthalmology, Fukuoka University School of Medicine, Fukuoka, Japan; the 2Division of Genome Analysis, Research Center for Genetic Information, Medical Institute of Bioregulation, Kyushu University, Fukuoka, Japan; and the 3Department of Ophthalmology and Visual Science, Graduate School of Medicine, Chiba University, Chiba, Japan.


   Abstract
Top
 Abstract
Methods
 Results
 Discussion
 References
 
PURPOSE. To describe a hierarchical approach for efficient genetic diagnosis of autosomal dominant retinitis pigmentosa (adRP).

METHODS. Forty di-, tri-, or tetra-nucleotide repeats tightly linked to 10 genes known to be responsible for adRP were identified from the human genome sequence and used as markers in multiplex amplification and genotyping, followed by linkage analysis. Discordance of cosegregation of markers and the disease excluded the majority of the examined genes as candidates, and mutation screening for the remaining genes was performed.

RESULTS. With this strategy, examination of an adRP-affected family indicated that 3 of 10 candidate genes segregated concordantly with the disease. Further searches for mutations revealed a novel insertion and deletion in the last exon of a splicing factor gene, PRPF8.

CONCLUSIONS. This systematic approach facilitates the molecular diagnosis of adRP, which is known to have a highly heterogeneous genetic background.

Retinitis pigmentosa (RP) affects approximately 1.5 million people worldwide.1 Patients with RP experience night blindness, a gradual loss of peripheral visual field, and eventually loss of central vision, in most cases due to degeneration of the photoreceptor cells of the retina. The defective genes in RP are strikingly heterogeneous. There are autosomal dominant (adRP), autosomal recessive (arRP), X-linked (xlRP), and rare mitochondrial and digenic forms.2 To date, 13 genes are known to cause adRP, 21 cause arRP, and 5 cause xlRP according to RetNet (http://www.sph.uth.tmc.edu/RetNet/, provided in the public domain by the University of Texas Houston Health Science Center, Houston, TX) and other publications.3 4 Of the genes causing adRP, all but one (RP17) have been cloned: rhodopsin (RHO, also RP4 as earlier locus symbol),5 peripherin/RDS (RDS, RP7),6 7 neural retina leucine-zipper (NRL, RP27),8 RP1,9 cone-rod homeobox-containing (CRX),3 retinal outer segment membrane protein 1 (ROM1),10 retinal fascin (FSCN2),11 inosine monophosphate dehydrogenase 1 (IMPDH1, RP10),12 13 and Pim-1 kinase (PIM1K, RP9),14 and genes encoding pre-mRNA splicing factors PRPC8 (RP13), PRP31 (RP11), and HPRP3 (RP18), also designated as PRPF8, PRPF31 and HPRP3P, respectively, in GenBank (http://www.ncbi.nlm.nih.gov/Genbank/; provided in the public domain by the National Center for Biotechnology Information, Bethesda, MD).15 16 17 Identifying the causative gene of RP is an essential step in prenatal diagnosis, accurate prognosis, and proper genetic counseling, as well as for possible gene-specific and/or mutation-specific treatments of RP.18 19 Although the significance of the molecular diagnosis of the gene defect causing RP has been emphasized, and various tests are available for all the cloned genes, gene heterogeneity has made the molecular diagnosis complicated and often nondefinitive.

Based on the large prevalence survey by Sohocki et al.4 who analyzed 500 probands of RP and other inherited retinopathies against five known candidate genes, the disease-causing mutation was identified in one third of the subjects with adRP in Canada and the United States. Another six genes for adRP were cloned shortly after the survey, with the number of genes to be analyzed therefore doubling and the number of exons to be screened increasing sevenfold.11 12 13 14 15 16 17 To facilitate the molecular diagnosis for such highly heterogeneous disorders, a systematic diagnostic approach is necessary.

Genetic linkage analysis has offered a substantial role in identifying novel genes responsible for genetic disease. Even for diseases with known genes, linkage analysis is an essential tool for molecular diagnosis when more than two loci are candidates.20 However, linkage analysis has an intrinsic weakness, because the possibility of meiotic crossover between gene loci and the available genetic markers remains. Furthermore, analyzing multiple gene loci requires a considerable amount of time and laboratory resources. Nonetheless, we believe that examining the genomic information in the vicinity of the RP-causative genes by linkage analysis provides substantial information for a molecular diagnosis. To achieve the best results from limited numbers of individuals in a given pedigree, many tightly linked genetic markers with high heterozygosity must be examined, to maximize the chance of analyzing informative markers within a given family.

In the present study, we showed the feasibility of a hierarchical approach for molecular diagnosis of adRP. This approach involved collecting a set of genetic markers that were tightly linked to each of the candidate adRP genes. These markers were then amplified by multiplex polymerase chain reaction (PCR) and subjected to linkage analysis. Based on concordance or discordance of segregation for the markers and disease, candidate genes were selected and mutation screening for the candidate genes was performed.


   Methods
Top
 Abstract
 Methods
Results
 Discussion
 References
 
Clinical Description of adRP Family
The proband was a 56-year-old man of Japanese origin. He was identified as having night blindness by 10 years of age, and RP had been diagnosed. The best corrected visual acuity was 0.8 in both eyes. The fundus in both eyes showed a degenerative retina with typical peripheral bone spicules (Fig. 1) . The visual field was constricted to 10° in both eyes. A dark-adapted electroretinogram (ERG) showed a nonrecordable pattern in both eyes. Two offspring of the proband had received a diagnosis of RP at the ages of 3 and 2 years. The ERG was nonrecordable at the time of diagnosis. The proband had two affected brothers and a healthy sister. One brother, 59 years old, had a time course of disease expression similar to that of the proband, and the visual acuity declined to hand motion in both eyes. The family structure, including other members, is shown in Figure 2 . The study followed the tenets of the Declaration of Helsinki. Informed consent was obtained from all subjects involved in the study and the protocol was approved by the review board of Fukuoka University.



View larger version (101K):
[in this window]
[in a new window]
  		FIGURE 1. Fundus image of proband (II-4) showing attenuated arterioles, a waxy optic disc, and diffuse peripheral bone spicules.

 


View larger version (29K):
[in this window]
[in a new window]
  		FIGURE 2. Pedigree of the adRP family. Filled symbols: individuals with diagnosed RP; filled boxes: haplotype shared among affected individuals (presumed mutation-carrying haplotype); open box: haplotype identical with the presumed mutation-carrying haplotype but inherited from normal individuals. (A) Genes perfectly cosegregated with disease trait. (B) RP1 showing consistent segregation with the trait, but markers of one individual (II-4) were uninformative and inheritance of a mutated allele to the two siblings was not definitively determined. Hatched box: confounding haplotype. (C) Remainder of the genes, inheritance of which was discordant with the trait. The most likely position of recombinants is shown by horizontal bars or edges of boxes. Note that an allele of marker 4 of RHO seemed not to be amplified and was denoted by 0. An allele of marker 4 of FSCN2 was regarded to be mutated in individual II-6 (*).

 
Candidate Genes
Of the 13 genes causing adRP, 10 were targeted: RHO, RDS, CRX, NRL, RP1, FSCN2, PRPF8, PRPF31, HPRP3P, and IMPDH1. The ROM1 gene was not examined, because a recent report indicates only a small contribution of this gene to adRP.21 PIM1K had not yet been cloned at the start of this study. RP17 has yet to be cloned.

Search of Short Tandem Repeats and Primer Design
For each gene, except FSCN2, the human draft sequence data were retrieved from GenBank. The accession numbers of sequence contigs are NT_006025.4 (RHO), NT_023409.5 (RDS), NT_008101.5 (RP1), NT_019583.5 (NRL), NT_011190.5 (CRX), NT_010692.6 (PRPF8), NT_011148.6 (PRPF31), NT_029226.4 (HPRP3P), and NT_007933.8 (IMPDH1). Short tandem repeats (STRs) were chosen from the gene, basically within 300 kb, if the number of repetitions was more than 13 for dinucleotide repeats and more than 7 for tri- and tetranucleotide repeats. We could not accurately locate the FSCN2 gene on the draft sequence, although the gene locus has been established to be at 17q25. As an alternative way to search for novel markers, six known polymorphic microsatellite markers near the locus: AFMc008we1, AFMa133yg9, GATA65G11, AFM107ye3, AFM210xa5, and AFM163yg1, encompassing approximately 6 cM, were selected from the Gènèthon (www.genethon.fr; provided in the public domain by the French Association against Myopathies, Evry, France)22 and The Cooperative Human Linkage Center (CHLC; http://gai.nci.nih.gov/provided in the public domain by the Laboratory for Population Genetics, Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institutes of Health) databases.23

Four to 12 candidate STRs were selected for each gene, and primer sequences were designed using Primer3 (http://www-genome.wi.mit.edu; provided in the public domain by the Whitehead Institute, Massachusetts Institute of Technology, Cambridge, MA) after masking interspersed repetitive elements with RepeatMasker (http://ftp.genome.washington.edu/cgi-bin/RepeatMasker/provided in the public domain by the University of Washington Genome Center, Seattle, WA). One of the 5'-ends of each primer pair was modified for post-PCR fluorescent labeling24 to contain either a GTT or ATT for the purpose of a 3'-exchange labeling reaction with N,N'-diethyl-2',7'-dimethyl-6-carboxyrhodamine labeled deoxycytidine 5'-triphosphate (R6G-dCTP; Applied Biosystems, Foster City, CA) or with 6-carboxyrhodamine labeled deoxyuridine 5'-triphosphate (R110-dUTP; Applied Biosystems), respectively. The 5' end of the other primer was modified to contain TCC to prohibit labeling. By including the two different dyes (R6G and R110) in the same labeling reaction tubes, we could label several PCR products differentially, with two colors. The PCR primers from the same gene were designed so that the size of the fragments using the same color did not overlap each other in the multiplex analysis (i.e., allowing simultaneous separation in one run of electrophoresis).

Screening of Polymorphic STRs
Genomic DNA from five unrelated healthy individuals (Japanese) served as an initial screen for polymorphisms in the STRs. STR markers were amplified by 30 cycles of three-step PCR, as described previously.24 An aliquot of each PCR product was examined by agarose gel electrophoresis to confirm specific amplification. The remainder of the amplification products served as substrates for post-PCR fluorescent labeling and fragment length analysis, as described previously.24 STRs, for which at least one of five individuals were heterozygous, were regarded to be sufficiently polymorphic and were used in further analyses.

Optimization of Multiplex PCR
A set of amplicons for multiplex PCR were created with primers for the STRs of each gene. Initially, primers were simply mixed at equal concentration and a 40-cycle PCR performed, followed by labeling and electrophoresis. Based on the results, primer sets for unsuccessful STR amplifications were eliminated and the PCR was repeated. Concentrations of the primers were then adjusted to obtain peak heights of the same magnitude for all loci in the multiplex analysis.

Fragment Length Analysis
Capillary electrophoresis was performed with a gene sequencer (ABI 310 or 3700; Applied Biosystems) under the conditions suggested by the manufacturer. The dye matrix for the analysis using the 3700 Gene Analyzer was modified and optimized for the dyes used in this study. Data collection and allele identification was performed on computer (GeneScan and Genotyper software; Applied Biosystems).

Genotyping of adRP Family
Seven individuals of the adRP family participated in this study (Fig. 2) . DNA was isolated from peripheral blood using a DNA extraction kit (QiaAmp; Qiagen, Chatsworth, CA). Genotyping was performed as described earlier, and haplotypes were determined with GeneHunter25 (http://linkage.rockefeller.edu/soft/gh/provided in the public domain by Rockefeller University, New York, NY).

Mutation Screening
Based on the results of the linkage analysis for each gene locus, remaining candidate genes were analyzed by denaturing high-performance liquid chromatography (DHPLC).26 The corresponding genomic sequences of the genes were retrieved, and oligonucleotide primers were designed by Primer3, so that each exon was bracketed by the intronic primers. Before analyzing the patients’ samples, the optimal annealing temperature for PCR was determined empirically. After 30 cycles of PCR in a total volume of 20 µL, the amplification products were applied to DHPLC. Once the DNA fragments for which heterogeneous mobility in DHPLC were segregated with disease trait, direct sequencing was performed with a kit (BigDye Terminator Sequencing; Applied Biosystems) after treatment with shrimp alkaline phosphatase (Amersham Pharmacia Biotech, Parsippany, NJ) and exonuclease I (Amersham). The samples were denatured and analyzed with a DNA sequencer (3700 Gene Analyzer; Applied Biosystems). Mutation in exon 42 of PRPF8 was analyzed with a 217-bp PCR fragment generated with the primers 5'-ATTAGCAGGAGGCAGGGAAAC-3' and 5'-GTTGCCCTGTTAACATTGGCTGT-3', to which the tagged sequences (5'-ATT and 5'-GTT) were added for postlabeling purposes.24


   Results
Top
 Abstract
 Methods
 Results
Discussion
 References
 
Candidate STRs of RP Genes
Genomic sequences were obtained for nine adRP genes from GenBank. The length of the sequences varied from 286 to 6109 kb (median, 1262). More than half of the STRs identified in the sequences were not suitable for designing primers, because they were juxtaposed with repeated sequences. Except for HPRP3P, the distance of each STR from the RP gene differed from 0 kb (within intron) to 280 kb (average, 110 kb). Only one STR in the contig containing HPRP3P (NT_029226.4, 860 kb) was suitable for the present analysis Therefore, an additional three STRs were picked up from neighboring contig (NT_004811.8) by referring to the Human Genome Browser (http://genome.ucsc.edu/provided in the public domain by UCSC Genome Bioinformatics, University of California at Santa Cruz, Santa Cruz, CA). These were two anonymous STRs in NT_004811.8 and one Gènèthon marker (AFM135yc3). Four markers located less than 1 cM from HPRP3P were used. Six known STR markers were chosen for FSCN2. The detailed data of the STRs including the primer sequences, precise location, and heterozygosity are available from the first author on request (hkondo@fukuoka-u.ac.jp).

Among the 58 STRs of which DNA fragments were successfully amplified, 53 (91%) showed polymorphisms among the five normal individuals. Poor amplification was observed for some of the markers under multiplex PCR conditions. Subsequently, 40 (69%) of 53 polymorphic STRs were used for multiplex amplification. Three to six STRs were used for each subset of multiplex PCR for each of the 10 genes. PCR product size, deduced from draft sequence data, ranged from 107 to 308 bp (average, 176 bp). The 40 markers consisted of 33 dinucleotide, 2 trinucleotide, and 5 tetranucleotide markers, of which 18 markers were labeled by R6G and 22 markers by R110. On the basis of five normal unrelated individuals analyzed, the number of alleles varied from two to six (median, three) and heterozygosity from 0.18 to 0.82 (average, 0.57).

Genotyping of the adRP-Affected Family
Ten PCRs for 10 gene loci were performed for each individual. A computer program (GeneScan; Applied Biosystems) produced clear chromatograms (Fig. 3) . Although fluorescein signals for the amplifications differed among STRs, all alleles were successfully genotyped by computer (Genotyper software; Applied Biosystems). Among the 40 STRs genotyped, all but two markers were consistent with Mendelian inheritance. One allele in marker 4 of RHO was not amplified in some individuals. We assumed this was due to the presence of a null allele. One allele of marker 4 of FSCN2 gene was regarded as a mutation in individual II-6, as shown in Figure 2 .



View larger version (29K):
[in this window]
[in a new window]
  		FIGURE 3. Chromatograms showing 40 markers of the proband (II-4) analyzed by multiplex PCR and post-PCR labeling. Markers are indicated by numbers (newly developed markers) or locus IDs (GenBank) corresponding to Figure 2 . Asterisk in (6): fortuitous PCR products.

 
Haplotype analysis indicated that the 10 adRP genes examined herein were divided into two categories (Table 1) : RHO, RDS, NRL, CRX, PRPF31, HPRP3P, and FSCN2 showed discordant segregation with the disease trait (Fig. 2C) , and PRPF8, IMPDH1, and RP1 showed perfect cosegregation with the trait (Figs. 2A 2B) . However, as was true of RP1, both haplotypes for individual II-4 were identical. Thus, less information was available with the markers used in this study (Fig. 2B) .


View this table:
[in this window]
[in a new window]
  		TABLE 1. adRP Genes and Haplotype Cosegregation with the adRP Family

 
Searching for Mutation
From the results just described, we assumed that PRPF8 and IMPDH1 were the candidate genes to be analyzed with high priority. The previous reports suggest that patients with the PRPF8 mutation exhibit early onset of disease symptoms, whereas those with mutation in IMPDH1 have late-onset disease.27 28 All affected individuals of the family showed an early onset of symptoms. Thus, we started searching for mutation in PRPF8. In particular, we focused on exon 42 of the gene, where previously reported mutations were exclusively located.15 20

Amplified DNA of exon 42 of PRPF8 showed a heterogeneous mobility in DHPLC in all affected individuals. Fragment size analysis revealed an extra peak 5 bp longer than the normal allele (Fig. 4 , left). Sequence analysis revealed a 6-bp deletion and 11-bp insertion of the coding nucleotides at nucleotides 6972 to 6977 (Fig. 4 , right). Because of the frame shift of the coding sequence, the last 11 amino acids (codons 2325 to 2335: VYSADREDLYA) were replaced by a longer putative sequence (TLCSLRIGRTCMPDRFPASCFSLPRPKPQPLQTGR) in the mutated allele. The deleted residues contain highly conserved sequence (DRED) across homologous genes in Mus musculus, Drosophila melanogaster, Caenorhabditis elegans, and Arabidopsis thaliana.



View larger version (57K):
[in this window]
[in a new window]
  		FIGURE 4. A substitutional mutation in the PRPF8 gene of the adRP-affected family. Fragment size analysis of amplified DNA of exon 42 of PRPF8 from affected individual II-2 revealed an extra 5-bp longer peak (bottom left) than the peak (top left) detected in normal individual II-6. Sequence analysis of affected patients revealed a sequence that was a mixture of a normal (N, top right) and a mutated allele (M, bottom right), which carried a 6-bp deletion (reddish bar in N allele) and 11-bp insertion (bluish bar in M allele). A part of altered amino acid sequence is underscored (bottom right).

 

   Discussion
Top
 Abstract
 Methods
 Results
 Discussion
References
 
We showed that a linkage-based exclusion screening, with multiplex linkage analysis with locus-specific microsatellite markers, is an efficient and practical method for narrowing the candidate genes responsible for adRP. Examination of an adRP-affected family by using this strategy indicated that 3 of 10 candidate genes segregated concordantly with the disease. A further search for mutations revealed a novel insertion and deletion in the last exon of a splicing factor gene, PRPF8.

With highly accurate human genome sequence data now available in the GenBank public database, it is possible to collect informative markers, such as microsatellites, that are tightly linked to most of the genes. By performance of linkage analysis with these markers, many of the candidate genes responsible for genetically heterogeneous hereditary diseases can be efficiently excluded. The efficiency of exclusion depends on the number of meioses (n) within the examined family. In the case of highly penetrant autosomal dominant diseases such as adRP, incidence of false loci remaining by chance after the exclusion test is given by (1/2)n, if the phase is known (i.e., if the DNA of grandparents of the affected parent are available for the study).29 For a nuclear family comprising parents and offspring, the chance is (1/2)n-1, because the phase is unknown. Thus, for a nuclear family with four children, the probability of failing to exclude nonresponsive genes under such phase-unknown conditions is 1 in 8, if markers associated with the candidate genes are fully informative. In this study, seven individuals (four plus two meioses with unknown phase) were genotyped, and one (or two) false and one true locus remained, after examination of 10 loci, a number close to that expected.

To facilitate the genotyping, we multiplexed the analysis by PCR. In general, optimization of multiplex PCR is a tedious step because of the interaction of primer sets, which may drastically affect product yield, even if nonspecific amplification and formation of primer dimers are avoided.30 However, once the optimization is reached, multiplex PCR is a highly efficient method of genotyping many loci. To analyze 10 gene loci, this method requires 10 PCRs and postlabeling per individual, thus the whole genotyping was accomplished by 70 reactions in this study. As an alternative, direct sequencing and/or DHPLC of the common adRP genes in a single proband may be comparable in cost and labor. However, such common genes differ widely in different ethnicities, as between the United States and Japan, and remain unknown in most ethnicities.11 An advantage of postlabeling in the multiplex genotyping is that sets of markers can be easily revised when the genomic sequence is updated (e.g., FSCN2 and HPRP3P). Toward more efficient use of this method, other candidate genes will be incorporated, such as PIM1K. Although we used 5 individuals to test the polymorphism of microsatellite markers, 50 individuals would give a more accurate representation of the number of different alleles in people and of the heterozygosity fraction. In this study, most markers were located within 500 kb of the candidate genes, so that they are also suitable markers for use in linkage disequilibrium analysis in the future.31

McKie et al.15 identified the gene in the RP13 locus to be PRPF8, a human homologue of the yeast PRP8. PRP8 is expressed ubiquitously and is a component of the spliceosome, an RNA-protein complex consisting of at least 50 proteins and five small nuclear RNAs that are involved in removal of introns of pre-mRNA.32 The association of the defects in the splicing process with RP is unknown. PRP8 exhibits striking phylogenetic conservation but has no obvious functional motifs, precluding testable predictions for its activity.32 So far, mutations in RP13 have been shown clustered within a 14-codon stretch in the last exon of PRPF8.15 20 The mutations reported previously were all missense and associated with a relatively severe phenotype, suggesting a dominant negative mechanism for disease causation.15 33 In this study, we identified a novel mutation of the PRPF8 gene (i.e., a frame-shift mutation that affects C-terminal 11-amino-acid residues). The additional amino acids at the C terminus due to the frame shift could also be responsible for altering the protein in such a way as to cause a dominant negative effect.


   Acknowledgements
 
The authors thank the family members who participated in this study for their cooperation and Hideyuki Hayashi for helpful discussion of the manuscript.


   Footnotes
 
Supported by the Japanese Retinitis Pigmentosa Society.

Submitted for publication September 2, 2002; revised October 7, 2002; accepted October 10, 2002.

Disclosure: H. Kondo, None; T. Tahira, None; A. Mizota, None; E. Adachi-Usami, None; K. Oshima, None; K. Hayashi, None

The publication costs of this article were defrayed in part by page charge payment. This article must therefore be marked "advertisement" in accordance with 18 U.S.C. §1734 solely to indicate this fact.

Corresponding author: Hiroyuki Kondo, Department of Ophthalmology, Fukuoka University School of Medicine, 7-45-1, Nanakuma, Jonan-ku, Fukuoka, 814-0180, Japan; hkondo{at}fukuoka-u.ac.jp.


   References
Top
 Abstract
 Methods
 Results
 Discussion
 References
 

  1. Berson, EL. (1993) Retinitis pigmentosa. The Friedenwald Lecture Invest Ophthalmol Vis Sci 34,1659-1676[Free Full Text]
  2. Heckenlively, JR, Daiger, SP. (2001) Hereditary retinal and choroidal degenerations Rimoin, DI Connor, JM Pyeritz, RE eds. Principles and Practice of Medical Genetics ,2255-2576 Churchill Livingstone New York.
  3. Sohocki, MM, Sullivan, LS, Mintz-Hittner, HA, et al (1998) A range of clinical phenotypes associated with mutations in CRX, a photoreceptor transcription-factor gene Am J Hum Genet 63,1307-1315[CrossRef][Medline][Order article via Infotrieve]
  4. Sohocki, MM, Daiger, SP, Bowne, SJ, et al (2001) Prevalence of mutations causing retinitis pigmentosa and other inherited retinopathies Hum Mutat 17,42-51[CrossRef][Medline][Order article via Infotrieve]
  5. Dryja, TP, McGee, TL, Reichel, E, et al (1990) A point mutation of the rhodopsin gene in one form of retinitis pigmentosa Nature 343,364-366[CrossRef][Medline][Order article via Infotrieve]
  6. Kajiwara, K, Hahn, LB, Mukai, S, et al (1991) Mutations in the human retinal degeneration slow gene in autosomal dominant retinitis pigmentosa Nature 354,480-483[CrossRef][Medline][Order article via Infotrieve]
  7. Farrar, GJ, Kenna, P, Jordan, SA, et al (1991) A three-base-pair deletion in the peripherin-RDS gene in one form of retinitis pigmentosa Nature 354,478-480[CrossRef][Medline][Order article via Infotrieve]
  8. Bessant, DA, Payne, AM, Mitton, KP, et al (1999) A mutation in NRL is associated with autosomal dominant retinitis pigmentosa Nat Genet 21,355-356[CrossRef][Medline][Order article via Infotrieve]
  9. Sullivan, LS, Heckenlively, JR, Bowne, SJ, et al (1999) Mutations in a novel retina-specific gene cause autosomal dominant retinitis pigmentosa Nat Genet 22,255-259[CrossRef][Medline][Order article via Infotrieve]
  10. Kajiwara, K, Berson, EL, Dryja, TP. (1994) Digenic retinitis pigmentosa due to mutations at the unlinked peripherin/RDS and ROM1 loci Science 264,1604-1608[Abstract/Free Full Text]
  11. Wada, Y, Abe, T, Takeshita, T, et al (2001) Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa Invest Ophthalmol Vis Sci 42,2395-2400[Abstract/Free Full Text]
  12. Bowne, SJ, Sullivan, LS, Blanton, SH, et al (2002) Mutations in the inosine monophosphate dehydrogenase 1 gene (IMPDH1) cause the RP10 form of autosomal dominant retinitis pigmentosa Hum Mol Genet 11,559-568[Abstract/Free Full Text]
  13. Kennan, A, Aherne, A, Palfi, A, et al (2002) Identification of an IMPDH1 mutation in autosomal dominant retinitis pigmentosa (RP10) revealed following comparative microarray analysis of transcripts derived from retinas of wild-type and Rho(-/-) mice Hum Mol Genet 11,547-557[Abstract/Free Full Text]
  14. Keen, TJ, Hims, MM, McKie, AB, et al (2002) Mutations in a protein target of the Pim-1 kinase associated with the RP9 form of autosomal dominant retinitis pigmentosa Eur J Hum Genet 10,245-249[CrossRef][Medline][Order article via Infotrieve]
  15. McKie, AB, McHale, JC, Keen, TJ, et al (2001) Mutations in the pre-mRNA splicing factor gene PRPC8 in autosomal dominant retinitis pigmentosa (RP13) Hum Mol Genet 10,1555-1562[Abstract/Free Full Text]
  16. Vithana, EN, Abu-Safieh, L, Allen, MJ, et al (2001) A human homolog of yeast pre-mRNA splicing gene, PRP31, underlies autosomal dominant retinitis pigmentosa on chromosome 19q13.4 (RP11) Mol Cell 8,375-381[CrossRef][Medline][Order article via Infotrieve]
  17. Chakarova, CF, Hims, MM, Bolz, H, et al (2002) Mutations in HPRP3, a third member of pre-mRNA splicing factor genes, implicated in autosomal dominant retinitis pigmentosa Hum Mol Genet 11,87-92[Abstract/Free Full Text]
  18. Ali, RR, Sarra, GM, Stephens, C, et al (2000) Restoration of photoreceptor ultrastructure and function in retinal degeneration slow mice by gene therapy Nat Genet 25,306-310[CrossRef][Medline][Order article via Infotrieve]
  19. Vollrath, D, Feng, W, Duncan, JL, et al (2001) Correction of the retinal dystrophy phenotype of the RCS rat by viral gene transfer of Mertk Proc Natl Acad Sci USA 98,12584-12589[Abstract/Free Full Text]
  20. van Lith-Verhoeven, JJ, van der Velde-Visser, SD, Sohocki, MM, et al (2002) Clinical characterization, linkage analysis, and PRPC8 mutation analysis of a family with autosomal dominant retinitis pigmentosa type 13 (RP13) Ophthalmic Genet 23,1-12[CrossRef][Medline][Order article via Infotrieve]
  21. Martinez-Mir, A, Vilela, C, Bayes, M, et al (1997) Putative association of a mutant ROM1 allele with retinitis pigmentosa Hum Genet 99,827-830[CrossRef][Medline][Order article via Infotrieve]
  22. Dib, C, Faure, S, Fizames, C, et al (1996) A comprehensive genetic map of the human genome based on 5,264 microsatellites Nature 380,152-154[CrossRef][Medline][Order article via Infotrieve]
  23. Sheffield, VC, Weber, JL, Buetow, KH, et al (1995) A collection of tri- and tetranucleotide repeat markers used to generate high quality, high-resolution human genome-wide linkage maps Hum Mol Genet 4,1837-1844[Abstract/Free Full Text]
  24. Kondo, H, Tahira, T, Hayashi, H, Oshima, K, Hayashi, K. (2000) Microsatellite genotyping of post-PCR fluorescently labeled markers Biotechniques 29,868-872[Medline][Order article via Infotrieve]
  25. Kruglyak, L, Daly, MJ, Reeve-Daly, MP, Lander, ES. (1996) Parametric and nonparametric linkage analysis: a unified multipoint approach Am J Hum Genet 58,1347-1363[Medline][Order article via Infotrieve]
  26. O’Donovan, MC, Oefner, PJ, Roberts, SC, et al (1998) Blind analysis of denaturing high-performance liquid chromatography as a tool for mutation detection Genomics 52,44-49[CrossRef][Medline][Order article via Infotrieve]
  27. Tarttelin, EE, Plant, C, Weissenbach, J, et al (1996) A new family linked to the RP13 locus for autosomal dominant retinitis pigmentosa on distal 17p J Med Genet 33,518-520[Abstract/Free Full Text]
  28. McGuire, RE, Gannon, AM, Sullivan, LS, Rodriguez, JA, Daiger, SP. (1995) Evidence for a major gene (RP10) for autosomal dominant retinitis pigmentosa on chromosome 7q: linkage mapping in a second, unrelated family Hum Genet 95,71-74[Medline][Order article via Infotrieve]
  29. Terwilliger, J, Ott, J. (1994) Handbook of Human Genetic Linkage ,22-42 Johns Hopkins University Press Baltimore, MD.
  30. Henegariu, O, Heerema, NA, Dlouhy, SR, Vance, GH, Vogt, PH. (1997) Multiplex PCR: critical parameters and step-by-step protocol Biotechniques 23,504-511[Medline][Order article via Infotrieve]
  31. Kendler, KS, MacLean, CJ, Ma, Y, et al (1999) Marker-to-marker linkage disequilibrium on chromosomes 5q, 6p, and 8p in Irish high-density schizophrenia pedigrees Am J Med Genet 88,29-33[CrossRef][Medline][Order article via Infotrieve]
  32. Collins, CA, Guthrie, C. (2000) The question remains: is the spliceosome a ribozyme? Nat Struct Biol 7,850-854[CrossRef][Medline][Order article via Infotrieve]
  33. Baehr, W, Chen, CK. (2001) RP11 and RP13: unexpected gene loci Trends Mol Med 7,484-486[CrossRef][Medline][Order article via Infotrieve]



This article has been cited by other articles:


Home page
 Arch OphthalmolHome page
S. Walia, G. A. Fishman, J. Zernant-Rajang, K. Raime, and R. Allikmets
Phenotypic Expression of a PRPF8 Gene Mutation in a Large African American Family
Arch Ophthalmol, August 1, 2008; 126(8): 1127 - 1132.
[Abstract] [Full Text] [PDF]

Home page
 RNAHome page
R. J. GRAINGER and J. D. BEGGS
Prp8 protein: At the heart of the spliceosome
RNA, May 1, 2005; 11(5): 533 - 557.
[Abstract] [Full Text] [PDF]

Home page
 IOVSHome page
H. Kondo, M. Qin, A. Mizota, M. Kondo, H. Hayashi, K. Hayashi, K. Oshima, T. Tahira, and K. Hayashi
A Homozygosity-Based Search for Mutations in Patients with Autosomal Recessive Retinitis Pigmentosa, Using Microsatellite Markers
Invest. Ophthalmol. Vis. Sci., December 1, 2004; 45(12): 4433 - 4439.
[Abstract] [Full Text] [PDF]

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kondo, H.
Right arrow Articles by Hayashi, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kondo, H.
Right arrow Articles by Hayashi, K.

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS