IOVS Archives of Disease in Childhood
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


(Investigative Ophthalmology and Visual Science. 2007;48:5118-5124.)
© 2007 by The Association for Research in Vision and Ophthalmology, Inc.
DOI:  10.1167/iovs.07-0302

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via ISI Web of Science (2)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Brandt, C. R.
Right arrow Articles by Lehrer, R. I.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Brandt, C. R.
Right arrow Articles by Lehrer, R. I.

Evaluation of a {theta}-Defensin in a Murine Model of Herpes Simplex Virus Type 1 Keratitis

Curtis R. Brandt,1,2 Radeekorn Akkarawongsa,3 Sharon Altmann,4 Gilbert Jose,4 Aaron W. Kolb,1 Alan J. Waring,5 and Robert I. Lehrer5

1From the Departments of Ophthalmology and Visual Science, 2Medical Microbiology and Immunology, 3Program in Cell and Molecular Biology, and the 4Microbiology Doctoral Training Program, University of Wisconsin-Madison, Madison, Wisconsin; and the 5Department of Medicine University of California at Los Angeles, Los Angeles, California.


    Abstract
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
PURPOSE. To test the activity of a synthetic {theta}-defensin, retrocyclin (RC)-2, in a murine herpes simplex virus (HSV)-1 keratitis model.

METHODS. The in vitro antiviral activity of RC-2 against HSV-1 KOS was determined by yield reduction and viral inactivation assays. Efficacy in an experimental murine HSV-1 keratitis model was tested using pre- or postinfection treatment with 0.1% peptide in PBS with or without 2% methylcellulose. Viral titers in the tear film were determined by plaque assay.

RESULTS. RC-2 inhibited HSV-1 KOS in vitro with an EC50 of 10 µM (~20 µg/mL) in yield-reduction assays, but was not directly virucidal. RC-106 (a less active analogue) did not inhibit HSV-1 KOS in culture. Incubating the virus with RC-2 or applying the peptide in 2% methylcellulose to the cornea before viral infection significantly reduced the severity of ocular disease, but postinfection treatment with 0.1% RC-2 in PBS with or without 2% methylcellulose did not. Viral titers were significantly reduced on some days after infection in the preincubation and prophylaxis groups.

CONCLUSIONS. RC-2 was active against HSV-1 KOS in cultures and showed protective activity in vivo when used in a prophylactic mode, but the peptide showed limited activity in a postinfection herpes keratitis model. These findings support data obtained from experiments with HIV-1, HSV-2, and influenza A, indicating that RCs inhibit the entry of viruses rather than their replication.


Ocular infection with herpes simplex virus (HSV)-1 is the leading infectious cause of blindness in the United States.1 Unfortunately, the antiviral agents that are currently available to treat herpetic keratitis are not always effective.2 Adding steroids to treatment regimens to suppress inflammation has limited efficacy and is associated with side effects.2 3 For these reasons, there is a need to develop additional therapeutic options for HSV-1 ocular infections.

Endogenous antimicrobial peptides (AMPs) are key components of the innate host defense systems of plants, fungi, invertebrates, and vertebrates.4 Two families of AMPs predominate in mammals: cathelicidins5 and defensins.6 7 The cathelicidin AMPs are structurally diverse, but their biosynthetic precursors share a common 11-kDa "cathelin" domain.5 6 While some mammalian species (e.g., pigs and cattle) express more than 10 different cathelicidin AMPs, humans express only one: the peptide HCAP-18, also called LL-37.5

Defensin peptides comprise three subfamilies, the {alpha}-, ß- and {theta}-defensins. Humans express six different {alpha}-defensins6 and up to 30 distinct ß-defensins.8 {theta}-Defensin peptides are found only in Old World monkeys, gibbons, and orangutans9 and were selected for this study because they have broad-spectrum antiviral properties.10 11 12 13 {theta}-Defensins are circular octadecapeptides with six cysteines pairing to form a ladder-like disulfide array that connects their two antiparallel ß-sheets.14 Studies on the three {theta}-defensin peptides (RTD-1 to -3) isolated from the leukocytes or bone marrow of the rhesus macaque15 16 17 revealed that {theta}-defensin (DEFT) genes are mutated {alpha}-defensin (DEFA) genes and that mature {theta}-defensin peptides arise in vivo by post-translational trimming and ligation of two "demidefensin" precursors.15 16 The human genome contains multiple {theta}-defensin (DEFT) genes, including some that are transcribed.10 However, each human DEFT gene contains a premature stop codon that prevents translation of its expressed mRNA.9

The human cornea can express at least three ß-defensins. Two of them (HBD-1 and -3) are constitutively expressed.18 19 20 In contrast, HBD-2 expression is induced by cytokines and occurs during corneal wound healing.20 21 Other AMPs detected in human corneal samples include LEAP-1/hepcidin (DTHFPICIFCCGCCHRSSKCGMCCK), LEAP-2 (MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVA), and HCAP-18/LL-37.22

Studies have shown that the {theta}-defensin retrocyclin (RC)-2 inhibits HSV-1 MacIntyre and HSV-2 G, indicating that RC-2 is a broad-spectrum inhibitor of HSV.13 The goal of this study was to test the efficacy of a {theta}-defensin in a murine model of HSV-1-induced keratitis. RC-2, the {theta}-defensin selected for this study, is identical with RC-1, except for a single gly->arg substitution that enhances its potency against both HIV-123 and herpes simplex, type 2.13 The sequence of RC-2 is based on information encoded in two human {theta}-defensin pseudogenes. Thus, RC-2 arguably represents a {theta}-defensin that humans would express if some arboreal ancestor’s DEFT gene had not experienced a mutational event resulting in a premature stop codon.9


    Materials and Methods
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
Cell Culture and Virus
The procedures for growing Vero cells and preparing high-titer stocks of HSV-1 KOS have been described previously.24 Briefly, Vero cells were cultured in Dulbecco’s modified Eagle’s medium (DMEM) containing a 5% serum (1:1 mixture of defined supplemented calf serum and fetal bovine serum; Hyclone, Ogden, UT), 100 U/mL penicillin, 100 µg/mL streptomycin sulfate, and 10 mM HEPES (pH 7.4). High-titer stocks of HSV-1 strain KOS were prepared by inoculating Vero cells at a multiplicity of infection (MOI) of 0.1 to 0.01. When 90% of cells showed cytopathic effects, the cells were collected by scraping and centrifugation at 400g. The cell pellets were resuspended in one tenth the original volume of medium, frozen and thawed three times to release virus, and finally centrifuged at 2000g to remove debris. High-titer virus stocks were stored at –80°C.

Peptides
RC-2 and RC-106 were synthesized at the University of California, Los Angeles (model I 431 A; Applied Biosystems, Inc. [ABI], Foster City, CA), essentially as previously described.10 The two peptides are identical except for the residues 4 and 10, which are arginines (R) in RC-2 but are tyrosine (Y) and glycine (G) in RC-106 (Fig. 1) . RC-106, available in limited quantities, was not included in all studies. Peptide concentrations were determined as described previously.25 26


Figure 1
View larger version (24K):
[in this window]
[in a new window]

 
FIGURE 1. Retrocyclin structures. RCs are cyclic, 18-residue peptides with three disulfide bonds and a net positive charge. The structures of RC-2 and RC-106 are shown, with several residues of RC-2 numbered. Y denotes the tyrosine substitution for arginine in RC-106.

 
In Vitro Antiviral Activity
The inhibitory effect of RC peptides against HSV-1 KOS was tested in typical yield-reduction assays.25 26 Briefly, virus at an MOI of 2 was mixed with concentrations of peptide varying from 3.1 to 200 µM and immediately added to Vero cell monolayers. After a 24-hour incubation, the cells were harvested by scraping. They were frozen and thawed three times, and infectious virus titers were determined on Vero cell monolayers. Direct virucidal activity was tested by incubating high-titer virus stocks (1 x 108 PFU/mL) with various peptide concentrations for 1 hour at 37°C. Then, samples were serially diluted and the amount of infectious virus was determined on Vero cell monolayers, as just described.

Cytotoxicity Assay
The toxicity of RC-2 for Vero cells was tested in a dye-reduction assay, as describe previously.27 Briefly, Vero cells were seeded at a density of 1.5 x 104 cells per well in a 96-well microtiter plate. After incubation overnight at 37°C, 20 µL of medium containing the desired concentration (serial twofold dilution) of RC-2 was added. Control wells received medium only. As a positive control for toxicity, the bKLA peptide, which we previously showed was toxic to Vero cells, was included.25 After incubating the cells in the presence of peptide overnight at 37°C, 20 µL of cell proliferation assay reagent (Celltiter 96 AQueous One Solution; Promega, Madison, WI) was added to each well in a total volume of 120 µL of culture medium. The plates were incubated for 2 hours at 37°C, and the absorbance at 490 nm was determined in a plate reader (BioTek Instruments, Inc., Winooski, VT). All assays were performed in triplicate, and the data are presented as the mean ± SD.

Animal Inoculation
Four- to six-week-old female BALB/c mice (Harlan Sprague-Dawley, Indianapolis, IN) were used for all studies, and all treatment groups consisted of 10 mice each. The procedures for infecting mice are described elsewhere.24 28 29 Briefly, the right corneas were scratched three times vertically and three times horizontally with a sterile 30-gauge needle under isoflurane anesthesia. A 5-µL drop of DMEM (2% serum) containing 1.0 x 106 plaque-forming units (PFU) of HSV-1 KOS24 was applied to the scarified cornea, and the mice were returned to their cages. Four different treatment methods were used, with groups of 10 mice each. Group 1: To test the effect of preincubating virus with peptide, virus was incubated with peptide in DMEM (0.1% wt/vol final concentration) at 37°C for 1 hour and then used to infect mice (1 x 106 PFU/eye). No other treatment was given. Group 2: For postinfection treatment, eye drops (5 µL) containing 0.1% (wt/vol) RC-2 in PBS were administered starting 4 hours after infection and continued four times per day for 7 days. Group 3: The postinfection treatment regimen was repeated using RC-2 (0.1% wt/vol) suspended in PBS with 2% (wt/vol) methylcellulose. Methylcellulose was chosen because it is not toxic and is compatible with aqueous solutions. Group 4: To determine whether RC-2 had prophylactic activity, mice were anesthetized, and the cornea was scarified with a sterile 30-gauge needle. A 5-µL drop of RC-2 in 2% (wt/vol) methylcellulose (0.1% wt/vol final RC-2 concentration) was then applied to the cornea with a micropipette, and the mice were returned to their cages. Ten to 15 minutes later, the mice were reanesthetized, and a 5-µL drop of HSV-1 KOS (1 x 106 PFU) was added to the scarified cornea. The mice in this group received no other RC-2 treatments.

Disease Scoring
The severity of ocular disease was scored as we have described previously.24 28 29 Briefly, blepharitis was scored: 1+, puffy eyelids; 2+, puffy eyelids with some crusting; 3+, eye swollen shut with severe crusting; and 4+, eye completely swollen shut and crusted over. Vascularization was scored: 1+, <25% of the cornea involved; 2+, 25% to 50% corneal involvement; and 3+, >50% corneal involvement. Stromal disease was scored: 1+, cloudiness, some iris detail visible; 2+, iris detail obscured; 3+, cornea totally opaque; and 4+, corneal perforation. All animal experiments were approved by the UW-Madison Institutional Animal Care and Use Committee and conformed to the ARVO Statement for the Use of Animals in Ophthalmic and Vision Research. The disease severity data were analyzed with the Mann-Whitney U test.

Measurement of Ocular Viral Titers
On days 1, 3, 5, 7, 9, 11, and 13 after infection, samples were harvested from the mice as follows. The mice were anesthetized with isoflurane, and the infected cornea was flushed with 10 µL of serum-free DMEM. The rinse was added to 190 µL of serum-free DMEM and stored at –80°C until all samples had been collected. Serial 10-fold dilutions were quantified by using a standard plaque assay on Vero cells.24 Each group consisted of 10 mice, and significant differences were determined by Student’s t-test.


    Results
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
Effect of RC-2 on HSV-1 Strain KOS in Culture
RC-2 has been shown to inhibit HSV-1 strain MacIntyre and HSV-2 strain G.13 Activity against HSV-1 KOS was tested at an MOI of 2 by adding virus to various concentrations of RC-2 or RC-106 and immediately adding the mixtures to Vero cell monolayers. After 24 hours of culture in the presence of the peptides, the infectious virus concentration was measured by titering on Vero cells. RC-2 treatment caused a dose-dependent inhibition of viral replication with an EC50 of 10 µM (~20 µg/mL; Fig. 2A ). Viral replication was completely prevented by 200 µM RC-2 (~400 µg/mL). In contrast, the EC50 for RC-106, a less active control peptide, was ~75 µM (~150 µg/mL). There was an approximately 7-log difference in titers between RC-2 and RC-106 at 200 µM (Fig. 2A) . To determine whether RC-2 was virucidal, virus was mixed with various concentrations of the peptides and incubated at 37°C for 1 hour. After serially diluting the samples, their content of infectious virus was determined by plaque assay. As neither RC-2 nor RC-106 inactivated the virus (Fig. 2B) , the peptides were not directly virucidal. As shown in Figure 2C , RC-2 was not toxic to Vero cells at concentrations up to 100 µM. A concentration of 200 µM reduced cell viability by 39%. These results suggest that cytotoxic effects do not contribute to the antiviral activity of RC-2.


Figure 2
View larger version (9K):
[in this window]
[in a new window]

 
FIGURE 2. In vitro antiviral activity of {theta}-defensins against HSV-1 KOS. (A) Yield-reduction assay in which peptide was mixed with virus immediately before infection and was present at all times. The EC50 for RC-2 was 10 µM. RC-106 was inactive. (B) Virus-inactivation assay in which peptide was incubated with virus for 1 hour at 37°C and then serially diluted and titered by plaque assay. Both peptides were inactive in this assay. (C) Cytotoxicity of RC-2. (A, B): () RC-2; ({circ}) RC-106. (C): (•) RC-2; ({circ}) 10 µM bKLA peptide.

 
Effect of Preincubation of Virus with Peptide on Keratitis
Studies have shown that RC-2 interferes with HSV attachment and entry,13 suggesting that allowing the peptide and virus to interact before or during viral uptake would be effective in preventing disease. To test this notion, virus and peptide (0.1% final concentration in DMEM) were mixed, incubated at 37°C for 1 hour and then used to infect mice without further exposure to peptide. The severity of ocular disease was assessed. Sufficient amounts of the control RC-106 peptide were available for this study, and so mock and RC-106 control groups were included. Preincubation of virus and RC-2 resulted in a significant reduction (P < 0.05) in the severity of blepharitis on all days (Fig. 3A) . The control RC-106 peptide had some activity but the blepharitis scores for this group were not significantly different (P > 0.05) from those in the mock group on all days that were scored. Thus, preincubation of virus with RC-2 was more effective in preventing blepharitis than both the mock and RC-106 treatments.


Figure 3
View larger version (8K):
[in this window]
[in a new window]

 
FIGURE 3. Incubation of virus with RC-2 before infection reduced the severity of HSV-1 ocular disease. Virus was incubated with peptide (0.1% wt/vol) for 1 hour at 37°C before infection of the mice. No subsequent exposure to the peptide occurred. At various times after infection, the severity of ocular disease was determined. (A) Blepharitis; (B) corneal vascularization; (C) stromal disease. Each group consisted of 10 mice. (•) RC-2; ({blacktriangledown}) RC-106; ({circ}) HSV-1 KOS only.

 
Preincubating the virus with RC-2 reduced corneal vascularization on days 9 to 13 postinfection (PI), relative to mock-treated virus (Fig. 3B) . The differences in severity of vascularization between RC-2 and RC-106 were significant on days 11 and 13 (P < 0.05). At no time were vascularization differences between the RC-106 and untreated groups significant (P > 0.05).

The differences in stromal disease severity between untreated and RC-2-treated groups were significant (P < 0.05) on days 5 to 13 (Fig. 3C) . Stromal disease differed significantly between the RC-2 and RC-106 groups on days 9 to 13 (P < 0.05). Exposure of virus to RC-106 resulted in significantly less severe stromal disease compared with the untreated group on days 5, 7, and 11 (P < 0.05), suggesting that RC-106 was partially effective in reducing stromal disease.

Prophylactic Effect of RC-2
To assess the prophylactic potential of RC-2, we established a mouse model in which RC-2 in PBS with 2% methylcellulose was applied to the scarified cornea before virus was added. As shown in Figure 4 , blepharitis and vascularization scores were not significantly (Figs. 4A 4B) different between the mock- and RC-2-treated groups at any time (P > 0.05). The severity of stromal keratitis was lower in the RC-2 group on all days (Fig. 4C) but these differences were only significant on days 3, 5, and 7 (P < 0.05; Fig. 4C ). These results suggest that RC-2 delays the development of stromal disease in this model. As noted in the Methods section, RC-106 is difficult to prepare, and insufficient amounts were available for this experiment.


Figure 4
View larger version (8K):
[in this window]
[in a new window]

 
FIGURE 4. The effect of RC-2 in 2% (wt/vol) methylcellulose on HSV keratitis when placed on the cornea before infection. Mice were anesthetized with isoflurane, the right corneas were scarified, and 5 µL of either 2% (wt/vol) methylcellulose/PBS or 0.1% (wt/vol) RC-2 in 2% methylcellulose/PBS was applied to the cornea. Ten to 15 minutes later, the eyes were infected with 1 x 106 PFU of HSV-1 KOS. (A) Blepharitis; (B) corneal neovascularization; (C) stromal keratitis. Each group consisted of 10 mice. (•) Methylcellulose/PBS only; ({circ}) 0.1% (wt/vol) RC-2 in methylcellulose/PBS.

 
Effect of Postinfection Peptide Treatment on Ocular Disease
We next examined whether topical treatment with RC-2 applied after infection prevented the development of keratitis. Topical treatments with a 0.1% solution of peptide in PBS were initiated 4 hours after infection and continued four times per day for 7 days. On various days, the severity of blepharitis, corneal clouding, and corneal neovascularization were assessed. Postinfection treatment with RC-2 in PBS alone did not significantly reduce the severity of ocular disease (data not shown). We reasoned that delivery of RC-2 in PBS alone might lead to inefficient delivery or rapid flushing of the drug from the cornea, and so we repeated the postinfection therapy using RC-2 in PBS with 2% methylcellulose. The results are shown in Figure 5 . There were no significant differences in the severity of blepharitis, vascularization, or stromal keratitis between the vehicle only and RC-2 treatment groups at any time (P > 0.05). We conclude that RC-2 treatment was ineffective against HSV-1-induced keratitis when applied after infection with the formulation used and drug concentration tested.


Figure 5
View larger version (8K):
[in this window]
[in a new window]

 
FIGURE 5. The effect of postinfection treatment with RC-2 in PBS with 2% methylcellulose on HSV-1 ocular disease. Mice were infected with 1 x 106 PFU of HSV-1 KOS in 5 µL of DMEM and then treated with RC-2 (0.1% wt/vol) in PBS with 2% methylcellulose four times per day for 7 days. (A) Blepharitis; (B) corneal neovascularization; (C) stromal keratitis. Each group consisted of 10 mice. (•) Methylcellulose/PBS only; ({circ}) 0.1% (wt/vol) RC-2 in PBS with 2% (wt/vol) methylcellulose.

 
Effect of RC-2 on Viral Titers In Vivo
To determine whether the reduced disease severity in the mice infected with virus preincubated with RC-2 was reflected in ocular viral titers, tear film samples were collected at intervals, and infectious virus was titered on Vero cell monolayers. As shown in Table 1 , viral titers in the RC-2 group were approximately 3 logs lower than in the control or RC-106-treated groups on day 1 (P < 0.05). On days 5 and 7, the titers in all three groups were essentially equivalent. By day 9, the virus had been cleared in all three groups. Viral titers were also measured in mice treated with RC-2 prophylactically. The titers in the RC-2 group were approximately five times lower on day 1 after infection (P < 0.05). On day 7, viral titers dropped below the limit of detection in the RC-2 prophylaxis group compared with the mock treated mice (1.9 x 101 PFU). Virus cleared completely in both groups on day 9 after infection. These results are consistent with a modest in vivo antiviral effect in the prophylactic model.


View this table:
[in this window]
[in a new window]

 
TABLE 1. Ocular Viral Titers

 

    Discussion
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 
Certain {alpha}-, ß-, and {theta}-defensins show activity against diverse human viruses in cell culture, including HIV, HSV-1, and HSV-2, vaccinia virus, adenovirus, and influenza A.10 11 12 13 30 31 32 33 34 However, much less is known about their in vivo effects in animal models of viral infection. Recently, Hazrati et al.35 demonstrated that intravaginal application of human {alpha}-defensins protect mice from infection in a model of genital HSV-2 infection. Cole et al.36 reported that RC-101 prevents HIV-1 infection of an organlike construct of human cervicovaginal tissue. RC-101, an arg9->lys analogue of RC-1, is identical with RC-2 in 16 of 18 residues, differing only in that residue 9 of RC-101 is lysine and residue 10 is glycine, whereas both of these are arginine in RC-2.36

In this study, we examined the activity of a synthetic {theta}-defensin, RC-2, in a mouse model of HSV-1 keratitis. RC-2 was effective in cell culture against HSV-1 KOS, did not directly inactivate the virus, and was not toxic to Vero cells at concentrations up to 100 µM. Comparing the efficacy of RC-1 and RC-106 indicated that the anti-HSV-1 activity of RC-2 was sequence specific. Significant protection ensued when the virus was incubated with RC-2 before the mice were infected or when RC-2 in 2% methylcellulose was placed on the abraded cornea before viral infection. In contrast, the topical application of RC-2 in 2% methylcellulose after infection failed to reduce the severity of HSV keratitis.

The reduction in viral titers on day 1 with subsequent recovery to the levels seen in the control groups when virus was preincubated with RC-2 suggests that viral replication was delayed. Such a delay could allow time for host defenses to be activated, leading to reduced disease severity. Previous work using trifluorothymidine28 and a peptidomimetic antiviral29 revealed that a reduction in the severity of ocular HSV infection could result from either reducing viral titers by as little as 1 log or by enhancing clearance of virus from the eye. The data obtained for RC-2 reinforces the conclusion that it is not necessary to inhibit viral replication completely to achieve a significant therapeutic effect.

Several possibilities could explain the ineffectiveness of topical RC-2 when applied after infection. In studies with other viruses (e.g., HIV-1, influenza A, and HSV-2), RCs and other {theta}-defensins acted primarily as viral uptake inhibitors and had little effect after the virus had entered the cell.10 12 13 37 It is possible that using higher peptide concentrations or a vehicle or delivery system other than methylcellulose would have afforded more promising results. In addition, little is known about the uptake and distribution of peptides after topical corneal application; thus, further formulation and pharmacokinetic studies are needed. We are currently testing several other antiviral peptides4 25 27 in animal models to determine whether one of these may perform better than RC-2.

Animal-derived AMPs other than defensins can also inhibit HSV in cell culture, and some of these may deserve further testing. Among them are a 23-amino-acid analogue of melittin,38 an 18-residue peptide derived from the apolipoprotein A-I sequence,39 a 33-amino-acid peptide homologous to the heptad repeat region of bovine herpes virus type 1 glycoprotein B,40 a series of cationic {alpha}-helical peptides,41 lactoferrin, and peptides released from the amino terminus of lactoferrin by proteolytic digestion.42 43 To date, no publications describe the effects of these peptides on HSV in animal models.

After this project was initiated, a study that examined the effects of various defensins on in vitro and in vivo HSV-2 infections became available.35 That study compared the ability of nine human defensins (HD) to protect against HSV-2 infection. It was found that noncytotoxic concentrations of all six human {alpha}-defensins (HNP1 to 4, HD5, and HD6) and of human ß-defensin-3 inhibited HSV infection, but that two other ß-defensins, HBD1 and -2, lacked protective activity. HNP-4, HD6, and HBD3 acted primarily by preventing binding and entry, whereas HNP-1 to -3 and HD5 inhibited postentry events as well, affording protection even when added several hours after entry. Of note, human cervical epithelial cells that were incubated with HNP-1 or HD5 accumulated these peptides intracellularly. Overall, these findings demonstrate that various human defensins act at different (and often multiple) steps in the HSV life cycle. Although defensins that are highly effective as viral entry inhibitors may be optimal choices for disease prophylaxis, defensins such as HNP-1 to -3 or HD5 may be better choices for treating ongoing corneal infection.

Our observations that RC-2 had an effect only when preincubated with the virus or was present on the cornea before infection is consistent with data showing that defensins act to block attachment and/or entry of HSV-1 into cells. When RC-2 was given therapeutically after infection, we saw no effect, suggesting that RC-2 would not be useful for postinfection treatment unless the activity could be improved. As we have mentioned, additional pharmacokinetic and formulation studies are needed and could result in improved activity. Based on our results, the most effective use of RC-2 would be as a prophylactic agent to block HSV-1 corneal infection.


    Acknowledgements
 
The authors thank Inna Larsen and Elizabeth Froelich for administrative and editorial assistance and preparing the figures.


    Footnotes
 
Supported by National Eye Institute Grant EY07336 and National Institute of Allergy and Infectious Diseases Grants P01 AI52049 (CRB), AI 22838, and AI 37845 (RIL) and a National Eye Institute Core Grant for Vision Research (EY016665). SA was supported by National Institute on Aging predoctoral training grant award (AI155397).

Submitted for publication March 12, 2007; revised June 27, 2007; accepted September 7, 2007.

Disclosure: C.R. Brandt, None; R. Akkarawongsa, None; S. Altmann, None; G. Jose, None; A.W. Kolb, None; A.J. Waring, None; R.I. Lehrer (P)

The publication costs of this article were defrayed in part by page charge payment. This article must therefore be marked "advertisement" in accordance with 18 U.S.C. §1734 solely to indicate this fact.

Corresponding author: Curtis R. Brandt, Department of Ophthalmology and Visual Sciences, 6630 Medical Sciences Center, 1300 University Avenue, Madison, WI 53706; crbrandt{at}facstaff.wisc.edu.


    References
 Top
 Abstract
 Materials and Methods
 Results
 Discussion
 References
 

  1. Liesegang TJ. Herpes simplex virus epidemiology and ocular importance. Cornea. 2001;20:1–13.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  2. Herpetic Eye Disease Study Group. Oral acyclovir for herpes simplex virus eye disease: effect on prevention of epithelial keratitis and stromal keratitis. Arch Ophthalmol. 2000;118:1030–1036.[Abstract/Free Full Text]
  3. Wilhelmus KR, Gee L, Hauck WW, et al. Herpetic Eye Disease Study. A controlled trial of topical corticosteroids for herpes simplex stromal keratitis. Ophthalmology. 1994;101:1883–1895.discussion 1895–1896.[Medline][Order article via Infotrieve]
  4. Bulet P, Stocklin R, Menin L. Anti-microbial peptides: from invertebrates to vertebrates. Immunol Rev. 2004;198:169–184.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  5. Zanetti M. The role of cathelicidins in the innate host defenses of mammals. Curr Issues Mol Biol. 2005;7:179–196.[Web of Science][Medline][Order article via Infotrieve]
  6. Ganz T. Defensins and other antimicrobial peptides: a historical perspective and an update. Comb Chem High Throughput Screen. 2005;8:209–217.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  7. Sahl HG, Pag U, Bonness S, Wagner S, Antcheva N, Tossi A. Mammalian defensins: structures and mechanism of antibiotic activity. J Leukoc Biol. 2005;77:466–475.[Abstract/Free Full Text]
  8. Schutte BC, Mitros JP, Bartlett JA, et al. Discovery of five conserved beta-defensin gene clusters using a computational search strategy. Proc Natl Acad Sci USA. 2002;99:2129–233.[Abstract/Free Full Text]
  9. Nguyen TX, Cole AM, Lehrer RI. Evolution of primate theta-defensins: a serpentine path to a sweet tooth. Peptides. 2003;24:1647–154.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  10. Cole AM, Hong T, Boo LM, et al. Retrocyclin: a primate peptide that protects cells from infection by T- and M-tropic strains of HIV-1. Proc Natl Acad Sci USA. 2002;99:1813–1818.[Abstract/Free Full Text]
  11. Daher KA, Selsted ME, Lehrer RI. Direct inactivation of viruses by human granulocyte defensins. J Virol. 1986;60:1068–1074.[Abstract/Free Full Text]
  12. Leikina E, Delanoe-Ayari H, Melikov K, et al. Carbohydrate-binding molecules inhibit viral fusion and entry by crosslinking membrane glycoproteins. Nat Immunol. 2005;6:995–1001.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  13. Yasin B, Wang W, Pang M, Cheshenko N, et al. Theta defensins protect cells from infection by herpes simplex virus by inhibiting viral adhesion and entry. J Virol. 2004;78:5147–5156.[Abstract/Free Full Text]
  14. Trabi M, Schirra HJ, Craik DJ. Three-dimensional structure of RTD-1, a cyclic antimicrobial defensin from Rhesus macaque leukocytes. Biochemistry. 2001;40:4211–4221.[CrossRef][Medline][Order article via Infotrieve]
  15. Leonova L, Kokryakov VN, Aleshina G, et al. Circular minidefensins and posttranslational generation of molecular diversity. J Leukoc Biol. 2001;70:461–464.[Abstract/Free Full Text]
  16. Tang YQ, Yuan J, Osapay G, et al. A cyclic antimicrobial peptide produced in primate leukocytes by the ligation of two truncated alpha-defensins. Science. 1999;286:498–502.[Abstract/Free Full Text]
  17. Tran D, Tran PA, Tang YQ, Yuan J, Cole T, Selsted ME. Homodimeric theta-defensins from rhesus macaque leukocytes: isolation, synthesis, antimicrobial activities, and bacterial binding properties of the cyclic peptides. J Biol Chem. 2002;277:3079–3084.[Abstract/Free Full Text]
  18. Haynes RJ, Tighe PJ, Dua HS. Antimicrobial defensin peptides of the human ocular surface. Br J Ophthalmol. 1999;83:737–741.[Abstract/Free Full Text]
  19. Lehmann OJ, Hussain IR, Watt PJ. Investigation of beta defensin gene expression in the ocular anterior segment by semiquantitative RT-PCR. Br J Ophthalmol. 2000;84:523–526.[Abstract/Free Full Text]
  20. McDermott AM, Redfern RL, Zhang B. Human beta-defensin 2 is up-regulated during re-epithelialization of the cornea. Curr Eye Res. 2001;22:64–67.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  21. McDermott AM, Redfern RL, Zhang B, Pei Y, Huang L, Proske RJ. Defensin expression by the cornea: multiple signalling pathways mediate IL-1beta stimulation of hBD-2 expression by human corneal epithelial cells. Invest Ophthalmol Vis Sci. 2003;44:1859–1865.[Abstract/Free Full Text]
  22. McIntosh RS, Cade JE, Al-Abed M, et al. The spectrum of antimicrobial peptide expression at the ocular surface. Invest Ophthalmol Vis Sci. 2005;46:1379–1385.[Abstract/Free Full Text]
  23. Wang W, Owen SM, Rudolph DL, et al. Activity of alpha- and theta-defensins against primary isolates of HIV-1. J Immunol. 2004;173:515–520.[Abstract/Free Full Text]
  24. Grau DR, Visalli RJ, Brandt CR. Herpes simplex virus stromal keratitis is not titer-dependent and does not correlate with neurovirulence. Invest Ophthalmol Vis Sci. 1989;30:2474–2480.[Abstract/Free Full Text]
  25. Bultmann H, Brandt CR. Peptides containing membrane-transiting motifs inhibit virus entry. J Biol Chem. 2002;277:36018–36023.[Abstract/Free Full Text]
  26. Bultmann H, Busse JS, Brandt CR. Modified FGF4 signal peptide inhibits entry of herpes simplex virus type 1. J Virol. 2001;75:2634–2645.[Abstract/Free Full Text]
  27. Akkarawongsa R, Cullinan AE, Zinkel A, Clarin J, Brandt CR. Corneal toxicity of cell-penetrating peptides that inhibit Herpes simplex virus entry. J Ocul Pharmacol Ther. 2006;22:279–289.[CrossRef][Medline][Order article via Infotrieve]
  28. Brandt CR, Coakley LM, Grau DR. A murine model of herpes simplex virus-induced ocular disease for antiviral drug testing. J Virol Methods. 1992;36:209–222.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  29. Brandt CR, Spencer B, Imesch P, Garneau M, Deziel R. Evaluation of a peptidomimetic ribonucleotide reductase inhibitor with a murine model of herpes simplex virus type 1 ocular disease. Antimicrob Agents Chemother. 1996;40:1078–1084.[Abstract]
  30. Bastian A, Schafer H. Human alpha-defensin 1 (HNP-1) inhibits adenoviral infection in vitro. Regul Pept. 2001;101:157–161.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  31. Chang TL, Klotman ME. Defensins: natural anti-HIV peptides. AIDS Rev. 2004;6:161–168.[Medline][Order article via Infotrieve]
  32. Feng Z, Dubyak GR, Lederman MM, Weinberg A. Cutting edge: human beta defensin 3: a novel antagonist of the HIV-1 coreceptor CXCR4. J Immunol. 2006;177:782–786.[Abstract/Free Full Text]
  33. Tanabe H, Ouellette AJ, Cocco MJ, Robinson WE, Jr. Differential effects on human immunodeficiency virus type 1 replication by alpha-defensins with comparable bactericidal activities. J Virol. 2004;78:11622–11631.[Abstract/Free Full Text]
  34. Weinberg A, Quinones-Mateu ME, Lederman MM. Role of human beta-defensins in HIV infection. Adv Dent Res. 2006;19:42–48.[Abstract/Free Full Text]
  35. Hazrati E, Galen B, Lu W, et al. Human alpha- and beta-defensins block multiple steps in herpes simplex virus infection. J Immunol. 2006;177:8658–8666.[Abstract/Free Full Text]
  36. Cole AL, Herasimtschuk A, Gupta P, et al. The retrocyclin analog RC-101 prevents human immunodeficiency virus type 1 infection of a model human cervicovaginal tissue construct. Immunology. 2007;121:140–145.[CrossRef][Medline][Order article via Infotrieve]
  37. Gallo SA, Wang W, Rawat SS, et al. Theta-defensins prevent HIV-1 Env-mediated fusion by binding gp41 and blocking 6-helix bundle formation. J Biol Chem. 2006;281:18787–18792.[Abstract/Free Full Text]
  38. Baghian A, Jaynes J, Enright F, Kousoulas KG. An amphipathic alpha-helical synthetic peptide analogue of melittin inhibits herpes simplex virus-1 (HSV-1)-induced cell fusion and virus spread. Peptides. 1997;18:177–183.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  39. Srinivas RV, Birkedal B, Owens RJ, et al. Antiviral effects of apolipoprotein A-I and its synthetic amphipathic peptide analogs. Virology. 1990;176:48–57.[CrossRef][Medline][Order article via Infotrieve]
  40. Okazaki K, Kida H. A synthetic peptide from a heptad repeat region of herpesvirus glycoprotein B inhibits virus replication. J Gen Virol. 2004;85:2131–2137.[Abstract/Free Full Text]
  41. Jenssen H, Andersen JH, Mantzilas D, Gutteberg TJ. A wide range of medium-sized, highly cationic, alpha-helical peptides show antiviral activity against herpes simplex virus. Antiviral Res. 2004;64:119–126.[CrossRef][Web of Science][Medline][Order article via Infotrieve]
  42. Andersen JH, Jenssen H, Sandvik K, Gutteberg TJ. Anti-HSV activity of lactoferrin and lactoferricin is dependent on the presence of heparan sulphate at the cell surface. J Med Virol. 2004;74:262–271.[CrossRef][Medline][Order article via Infotrieve]
  43. Marchetti M, Trybala E, Superti F, Johansson M, Bergstrom T. Inhibition of herpes simplex virus infection by lactoferrin is dependent on interference with the virus binding to glycosaminoglycans. Virology. 2004;318:405–413.[CrossRef][Medline][Order article via Infotrieve]




This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a response
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via ISI Web of Science (2)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Brandt, C. R.
Right arrow Articles by Lehrer, R. I.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Brandt, C. R.
Right arrow Articles by Lehrer, R. I.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS